- Nup53 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92212
- Unconjugated
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- 0.1 ml
- This antibody was developed against Recombinant Protein corresponding to amino acids: DDSWVTVFGF PQASASYILL QFAQYGNILK HVMSNTGNWM HIRYQSKLQA RKALSKDGRI FGESIMIGVK PCID
- MP-44, MP44, NP44, NUP53
- Human
- PBS (pH 7.2) and 40% Glycerol
- Nup53
- Rabbit
- nucleoporin 35
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
DDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCID
Specifications/Features
Available conjugates: Unconjugated